DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG33461

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:286 Identity:65/286 - (22%)
Similarity:116/286 - (40%) Gaps:61/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVILGLIGLTAVGMCHAQG-------RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILT 63
            |.:||:.|.::|.:....|       :|:.|..|......:.|.|......:|.||:::|..:||
  Fly    15 LFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLINQWFVLT 79

  Fly    64 TAHCVHRDGKL------------IDASRLACRVGSTNQYAGGKIVNVESVAVHP--DYYNLNNNL 114
            :|||:..|.:|            ||.....| :.:|.:|      ||:.:..|.  |..:.:|::
  Fly    80 SAHCIEDDVELIARLGENNRDNDIDCENNRC-LEATQEY------NVDMLFKHRLYDPKDFSNDI 137

  Fly   115 AVITLSSELTYTDRITAIPLVASGEALPAEGSEVIV--------AGWGRTSDGTNSYKIR---QI 168
            .::.|...:.||..|..|.:      ......:::|        .|||.||...|:...|   ::
  Fly   138 GMLRLERRVEYTYHIQPICI------FHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMEL 196

  Fly   169 SLKVAPEATCLDAYSDHDEQSFCLAHELKEGT-----CHGDGGGGAIYGNTLIGLTNFV-VGACG 227
            :|...|...|...:    :|:| |:.::..|.     |.||.||.......:.|:..|| :|...
  Fly   197 NLYRRPRNDCARIF----KQNF-LSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIAS 256

  Fly   228 SRYPD-----VFVRLSSYADWIQEQI 248
            ..|.:     :...:..|..||::.:
  Fly   257 FTYENCSKVSILTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 55/240 (23%)
Tryp_SPc 42..244 CDD:214473 53/237 (22%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 57/254 (22%)
Tryp_SPc 42..281 CDD:238113 59/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.