DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG30323

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:232 Identity:46/232 - (19%)
Similarity:68/232 - (29%) Gaps:85/232 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGST-NQYAGGK--------------- 94
            || |.|.||:||...::|:..||            :.|..|| ||.:..|               
  Fly    50 DN-HFCAGSLLSAWWVVTSGCCV------------STRPESTPNQPSNRKNLRVVVFTPKRLKKP 101

  Fly    95 ----IVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRITAIP--------LVASGEALPAEGSE 147
                |.:|:.:.:.....:....||::.|...:|.......:|        |..|          
  Fly   102 SPKNIYHVQKIVLDESAISGCTELALLKLDRGVTGQRFAMMLPEKELNSTWLCNS---------- 156

  Fly   148 VIVAGWGRT--------------------------SDGTNSYKIRQISLKVAPEATCLDAYSDHD 186
               .||||.                          .||..|.::.||..:...|..|....|   
  Fly   157 ---LGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCS--- 215

  Fly   187 EQSFCLAHELKEGT-CHGDGGGGAIYGNTLIGLTNFV 222
             :..|:......|. |..|.|......:.|.|:...|
  Fly   216 -RCLCMTSYTGRGNMCQQDLGSPLFCDHFLYGVARRV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 46/232 (20%)
Tryp_SPc 42..244 CDD:214473 46/232 (20%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 46/232 (20%)
Tryp_SPc 45..272 CDD:214473 46/232 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.