DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG30286

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:243 Identity:55/243 - (22%)
Similarity:96/243 - (39%) Gaps:35/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAG---- 92
            |..:.:.:.|.|......||||::::...|||.|||:..|      ..|..|:|..|....    
  Fly    41 AHISESPWMAYLHKSGELVCGGTLVNHRFILTAAHCIRED------ENLTVRLGEFNSLTSIDCN 99

  Fly    93 -------GKIVNVESVAVHPDYYNLN--NNLAVITLSSELTYTDRITAIPLVASGEALP--AEGS 146
                   .:...::....|..|...|  :::.::.|:..:.|...|..|.|:.:....|  ....
  Fly   100 GSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLH 164

  Fly   147 EVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAY-SDHDEQSFCLAHELKEG-TCHGDGGGG- 208
            .::..||||:.....::.::.|.:.......|...| .|......|::||  .| :|.||.||. 
  Fly   165 RLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKTYWVDRRRDQICVSHE--SGVSCSGDSGGPM 227

  Fly   209 ----AIYGNTL---IGLTNFVVGACGSRYPDVFVRLSSYADWIQEQIA 249
                .:.|..|   :|:.::....|.|  |.||..:..:.|||...::
  Fly   228 GQAIRLDGRVLFVQVGIVSYGNAECLS--PSVFTNVMEHIDWIMAALS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 53/229 (23%)
Tryp_SPc 42..244 CDD:214473 51/226 (23%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 54/237 (23%)
Tryp_SPc 39..268 CDD:214473 53/236 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.