DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG30098

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:282 Identity:79/282 - (28%)
Similarity:128/282 - (45%) Gaps:58/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MQPRLVILGLIGLTAVG----------MCHA--QGRIMGGEDADATATTFTASLRVDNAHVCGGS 54
            |.|.:|:|..:.:..:|          .|.|  :.|::||:  :|..|.:.|.|..||...||||
  Fly     1 MTPAIVLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIGGQ--NARRTPWMAYLIRDNRFACGGS 63

  Fly    55 ILSQTKILTTAHCVHRDGKLI------DASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNL-NN 112
            :::...:||.|||...:..|.      |:||..  .|.|..|      .|.|:..|.:|.:. |:
  Fly    64 LIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTT--DGQTRSY------RVVSIYRHKNYIDFRNH 120

  Fly   113 NLAVITLSSELTYTDRITAI-PLVASG-EALPAEGSEVIVAGWGRTSDGTNSYK----IRQISLK 171
            ::||:.|..::.|...|..| .|:.|| ::|........:.|||:.:   :.||    ::::||:
  Fly   121 DIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMA---HYYKMPTTLQEMSLR 182

  Fly   172 VAPEATCLDAYSDHDEQSFCLAHELKEGTCHGDGGG--GAI--YGNTLI----GLTNFVVGACG- 227
                 ...:.|......|.|..:.: :..|.||.||  |::  ||:..|    |:||.|.|.|. 
  Fly   183 -----RVRNEYCGVPSLSICCWNPV-QYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDG 241

  Fly   228 -SRYPDVFVRLSSYADWIQEQI 248
             |.|.|    |.||..|:.:.:
  Fly   242 YSSYLD----LMSYMPWLYQTL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 66/227 (29%)
Tryp_SPc 42..244 CDD:214473 65/224 (29%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 71/240 (30%)
Tryp_SPc 37..258 CDD:238113 71/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.