DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG30087

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:258 Identity:58/258 - (22%)
Similarity:99/258 - (38%) Gaps:64/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQ 89
            |::.|::|...:..|...:..::...||||||:...|||.||||.        ..|..|:|..| 
  Fly    41 RVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHCVF--------PNLRLRLGEHN- 96

  Fly    90 YAGGKIVNVESVAVHPD----------------------YYNLN---NNLAVITLSSELTYTDRI 129
                       :...||                      :||..   |::|::.|:..:.:...|
  Fly    97 -----------IRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHI 150

  Fly   130 TAIPLVASGEALPAEGSEVI---VAGWGRTSDGTNSYKIRQISLKVAPEATC---LDAYSDHDEQ 188
            ..|.::.:    ||....|.   ..|||.|......:.::...|:....|.|   ..||.:.:: 
  Fly   151 QPICILLN----PASAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQ- 210

  Fly   189 SFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFV------VGACGSRYPDVFVRLSSYADWIQ 245
             .|..||.:: ||.||.||..:......|:..::      .|....:.|.|:..:.:|.:||:
  Fly   211 -ICAGHEERD-TCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 54/241 (22%)
Tryp_SPc 42..244 CDD:214473 52/238 (22%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 56/255 (22%)
Tryp_SPc 42..272 CDD:238113 57/257 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.