DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Try4

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:253 Identity:71/253 - (28%)
Similarity:121/253 - (47%) Gaps:21/253 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHR 70
            |:.|.|:|...........:|:||......:..:..||. ...|.||||:::...:::.|||.  
Mouse     4 LLFLALVGAAVAFPVDDDDKIVGGYTCRENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCY-- 65

  Fly    71 DGKLIDASRLACRVG--STNQYAGG-KIVNVESVAVHPDYYN--LNNNLAVITLSSELTYTDRIT 130
                  .||:..|:|  :.|...|. :.||...:..||::.:  |||::.:|.|:|.:|...|:.
Mouse    66 ------KSRIQVRLGEHNINVLEGNEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTLNARVA 124

  Fly   131 AIPLVASGEALPAEGSEVIVAGWGRT-SDGTNSYKIRQ-ISLKVAPEATCLDAYSDHDEQSFCLA 193
            .:.|.:|  ..|| |::.:::|||.| |.|.|:..:.| :...:.|:|.|..:|......:....
Mouse   125 TVALPSS--CAPA-GTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEASYPGKITNNMICV 186

  Fly   194 HELKEG--TCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQIA 249
            ..|:.|  :|.||.||..:....|.|:.::..|......|.|:.::.:|.||||..||
Mouse   187 GFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQNTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 62/213 (29%)
Tryp_SPc 42..244 CDD:214473 59/210 (28%)
Try4NP_035776.1 Tryp_SPc 23..239 CDD:214473 62/227 (27%)
Tryp_SPc 24..242 CDD:238113 65/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.