DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Prss38

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:262 Identity:70/262 - (26%)
Similarity:110/262 - (41%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCV 68
            |:.....|.|..|.|....||:::|||.|......:..||.....|:|||||||...:|:.|||.
Mouse    34 PKSQANSLSGDVACGQPVLQGKLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCF 98

  Fly    69 HRDGKLIDASRLACRVGSTNQYAGGKIV---NVESVAVHPD---YYNLNNNLAVITLSSELTYTD 127
            .| ||.::...:  .||.||.....:..   .:..|.:||.   |:.:..::|::.|.|.:.::|
Mouse    99 DR-GKKLETYDI--YVGITNLEKANRHTQWFEIYQVIIHPTFQMYHPIGGDVALVQLKSAIVFSD 160

  Fly   128 RITAIPLVASGEALPAEGSEVI-----VAGWGRTS-DGTNSYKIRQISLKVAPEATC--LDAYSD 184
            .:..|       .||.....:|     ..|||..| .|....::.:..|.:.|...|  |...|.
Mouse   161 FVLPI-------CLPPSDLYLINLSCWTTGWGMISPQGETGNELLEAQLPLIPRFQCQLLYGLSS 218

  Fly   185 HDEQSFCLAHELK--EGTCHGDGGGGAIYGNT----LIGLTNFVVGACGSRYPDVFVRLSSYADW 243
            :.......|.::|  :..|.||.|...:....    .||:.::..|.....||.||..:|.:..|
Mouse   219 YLLPEMLCAADIKTMKNVCEGDSGSPLVCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLSW 283

  Fly   244 IQ 245
            |:
Mouse   284 IR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/224 (26%)
Tryp_SPc 42..244 CDD:214473 57/221 (26%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 63/238 (26%)
Tryp_SPc 58..284 CDD:214473 61/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.