DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Prtn3

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:269 Identity:72/269 - (26%)
Similarity:106/269 - (39%) Gaps:72/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIGLTAVGMCHAQGRIMGGEDADATATTFTASL---RVDNAHVCGGSILSQTKILTTAHCVHRDG 72
            |:.|...|...| .:|:||.:|...:..:.|||   |...:|.|||:::....:||.|||:    
Mouse    16 LLALVVGGAVQA-SKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHCL---- 75

  Fly    73 KLIDASRLACRVGSTNQYAGGKIVNV-----ESVAVHPDY------------YNLNNNLAVITLS 120
                            |....::|.|     :.::..|:.            ||...||..:.| 
Mouse    76 ----------------QDISWQLVTVVLGAHDLLSSEPEQQKFTISQVFQNNYNPEENLNDVLL- 123

  Fly   121 SELTYTDRITAIPLVASGEALP------AEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCL 179
            .:|..|..:.....|||   ||      ::|::.:..||||.  ||.           ||....|
Mouse   124 LQLNRTASLGKEVAVAS---LPQQDQTLSQGTQCLAMGWGRL--GTQ-----------APTPRVL 172

  Fly   180 DAYSDHDEQSFCLAHEL-------KEGTCHGDGGGGAIYGNTLIGLTNFVVGACGS-RYPDVFVR 236
            ...:.......|..|.:       ..|.|.||.||..|....|.|:.:||:..|.| ::||.|.|
Mouse   173 QELNVTVVTFLCREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFAR 237

  Fly   237 LSSYADWIQ 245
            :|.|.||||
Mouse   238 VSMYVDWIQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 63/238 (26%)
Tryp_SPc 42..244 CDD:214473 60/235 (26%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 65/252 (26%)
Tryp_SPc 30..248 CDD:238113 68/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.