DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and PRSS36

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:254 Identity:67/254 - (26%)
Similarity:113/254 - (44%) Gaps:25/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLAC 82
            |......||:||.:|......:..||.....|:||||:::.:.:|:.|||...:|.|..|:..:.
Human    39 GRPEPSARIVGGSNAQPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFMTNGTLEPAAEWSV 103

  Fly    83 RVGSTNQ---YAGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITAIPLVASGEALP 142
            .:|..:|   ..|.....|.::.|..:|  ..|..:||::.|:|..:....:..:.|..:.... 
Human   104 LLGVHSQDGPLDGAHTRAVAAIVVPANYSQVELGADLALLRLASPASLGPAVWPVCLPRASHRF- 167

  Fly   143 AEGSEVIVAGWGRTSDGTN---SYKIRQISLKVAPEATCLDAYSDHDEQS---------FCLAH- 194
            ..|:.....|||...:...   .:.::::.|::..||||...||.....:         .|..: 
Human   168 VHGTACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQILPGMLCAGYP 232

  Fly   195 ELKEGTCHGDGGGGAIY---GNTL-IGLTNFVVGACGSR-YPDVFVRLSSYADWIQEQI 248
            |.:..||.||.||..:.   |... .|:|:|..| ||.| .|.||..:::|..||:||:
Human   233 EGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGFG-CGRRNRPGVFTAVATYEAWIREQV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/227 (26%)
Tryp_SPc 42..244 CDD:214473 57/224 (25%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 62/241 (26%)
Tryp_SPc 47..289 CDD:238113 63/243 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.