DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG43336

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:274 Identity:75/274 - (27%)
Similarity:121/274 - (44%) Gaps:51/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILGLIGLT-----AVGM-CHAQG--RIMGGEDADATATTFTASLR-VDNAHVCGGSILSQTKILT 63
            :|.|:|.|     |.|: .|:..  |:..|..|..|::.:.|.|. .|...:||||:::...:||
  Fly    12 LLPLLGSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVLT 76

  Fly    64 TAHCVHRDGKLIDASRLACRVGSTNQ---------YAGGKIVNVESVAVHPDYYN---LNNNLAV 116
            .|||      .:|.:.|..|:|..::         |...:|..:........:||   :..::|:
  Fly    77 AAHC------FLDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAI 135

  Fly   117 ITLSSELTYTDRITAIPLVASG------EAL-PAEGSEVIVAGWGRTSDGTNSYKIRQISL-KVA 173
            :.|..::.|||.|..|.:|...      ::| |..|:     |||:|....:|.|:|.:.| :..
  Fly   136 LRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGT-----GWGKTESEGDSAKLRTVDLARKH 195

  Fly   174 PEATCLDAYSDHDEQSFCLAHELKEGTCHGDGGG--GAI--YGNT----LIGLTNFVVGACGSRY 230
            ||.....|........||..:| :...|:||.||  ||:  ||.:    .:|:.:|....|  ..
  Fly   196 PEVCRRYATLSLTANQFCAGNE-RSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQC--VM 257

  Fly   231 PDVFVRLSSYADWI 244
            ..||..:.||.|||
  Fly   258 VSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 63/232 (27%)
Tryp_SPc 42..244 CDD:214473 61/230 (27%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 66/247 (27%)
Tryp_SPc 40..271 CDD:238113 65/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.