DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG43335

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:245 Identity:64/245 - (26%)
Similarity:113/245 - (46%) Gaps:38/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASR-LACRVGSTN 88
            ||:||.||:.|:..:.|.|..:..:.|.|::::...:||.|||       |:||: |..|:|.:.
  Fly    41 RIIGGSDAEITSHPWMAYLYNEFHYFCAGTLITNQFVLTAAHC-------IEASKNLTVRLGGSG 98

  Fly    89 -QYAGGKIVNVE------SVAVHPDYYN---LNNNLAVITLSSELTYTDRITAIPLVASGEALPA 143
             ..:.|.:..:.      |:|:...|:.   :.|::|:|.|:..:.:.|.|..|.::..    ||
  Fly    99 LTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILD----PA 159

  Fly   144 ------EGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEGTCH 202
                  :|..::..|||......:.:.:::..:.|.....|...|.....|....|.:.:..||.
  Fly   160 VRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQGQICAGDKETNTCL 224

  Fly   203 GDGG---GGAI--YGN---TLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244
            ||.|   ||.:  ||:   ...|:|:|  |....|.|.::..||:|:.||
  Fly   225 GDSGGPLGGVVNYYGDLRFVQYGITSF--GDIECRSPSIYTDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 56/228 (25%)
Tryp_SPc 42..244 CDD:214473 54/226 (24%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 62/243 (26%)
Tryp_SPc 42..275 CDD:238113 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436525
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.