DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG43125

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:95 Identity:22/95 - (23%)
Similarity:43/95 - (45%) Gaps:24/95 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CGGSILSQTKILTTAHCV-----------HRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVH 104
            |.|:::::..:||.|.|:           ..||.|.::|:|        ||   :.:.|....:|
  Fly    52 CTGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKL--------QY---EEIYVARALIH 105

  Fly   105 PDYYNLNN--NLAVITLSSELTYTDRITAI 132
            ..|.:.::  |:|::.|.:.:.|...|..|
  Fly   106 RSYSSESHQYNIALLRLKTSVVYKKNIQPI 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 22/95 (23%)
Tryp_SPc 42..244 CDD:214473 22/95 (23%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.