DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Prss28

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:281 Identity:62/281 - (22%)
Similarity:125/281 - (44%) Gaps:47/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLVILGL------IGLTAVGMCHAQG-RIMGGEDADATATTFTASLRVDN------AHVCGGSIL 56
            ||::|.|      :.:.:|.:..::. .|:||:........:..|||:.:      .|:|||||:
Mouse     3 RLLLLALSCLESTVFMASVSISRSKPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSII 67

  Fly    57 SQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLNN--NLAVITL 119
            ....|||.|||:....  .|.:....:||....|...:::|:..:.:||||.:::.  :||::.|
Mouse    68 HPQWILTAAHCIQSQD--ADPAVYRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLALMQL 130

  Fly   120 SSELTYTDRITAIPLVASGEALPAEGS------EVIVAGWGRTSDGT---NSYKIRQISLKVAPE 175
            ::.|..:..::.:       :||.:.|      :..:.|||......   ..|::.::.:.:...
Mouse   131 TALLVTSTNVSPV-------SLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDN 188

  Fly   176 ATCLDAY---SDHDEQSFCLAHEL------KEGTCHGDGGGGAIYGNT----LIGLTNFVVGACG 227
            .:|..||   |..:.::..:..::      ..|.|.||.||..:...:    .:|:.:..:. |.
Mouse   189 KSCKRAYRKKSSDEHKAVAIFDDMLCAGTSGRGPCFGDSGGPLVCWKSNKWIQVGVVSKGID-CS 252

  Fly   228 SRYPDVFVRLSSYADWIQEQI 248
            :..|.:|.|:.|...||.:.|
Mouse   253 NNLPSIFSRVQSSLAWIHQHI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 53/234 (23%)
Tryp_SPc 42..244 CDD:214473 51/231 (22%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 56/250 (22%)
Tryp_SPc 31..269 CDD:214473 54/247 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.