DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and KLK11

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:275 Identity:64/275 - (23%)
Similarity:124/275 - (45%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVH 69
            :|::|.|    |.|:...:.||:.|.:....:..:.|:|......:||.::::...:||.|||:.
Human    37 QLILLAL----ATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLK 97

  Fly    70 RDGKLIDASRLACRVGSTN---QYAGGKIVNV------------------ESVAVHPDYYNL--- 110
            ....|...:.::..:.|:|   .:....||::                  ||.. ||.:.|.   
Human    98 PWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTATESFP-HPGFNNSLPN 161

  Fly   111 ---NNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRTSDG--TNSYKIRQISL 170
               .|::.::.::|.::.|..:.  ||..|...:.| |:..:::|||.||..  ...:.:|..::
Human   162 KDHRNDIMLVKMASPVSITWAVR--PLTLSSRCVTA-GTSCLISGWGSTSSPQLRLPHTLRCANI 223

  Fly   171 KVAPEATCLDAYSDHDEQSFCLAHELKEG---TCHGDGGGGAIYGNTLIGLTNFVVGACG-SRYP 231
            .:.....|.:||..:...:...| .::||   :|.||.||..:...:|.|:.::....|. :|.|
Human   224 TIIEHQKCENAYPGNITDTMVCA-SVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKP 287

  Fly   232 DVFVRLSSYADWIQE 246
            .|:.::..|.|||||
Human   288 GVYTKVCKYVDWIQE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 55/238 (23%)
Tryp_SPc 42..244 CDD:214473 51/234 (22%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 55/251 (22%)
Tryp_SPc 54..303 CDD:238113 58/254 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.