DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG42694

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:215 Identity:43/215 - (20%)
Similarity:82/215 - (38%) Gaps:27/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DNAHV-CGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY-- 107
            :..|| |.||::|:..:|:.|.|:...|||.      .::|.:|.........|.:|.: |.:  
  Fly    52 NGTHVLCSGSLISKQFVLSAAQCIDVHGKLF------VQLGVSNATKSPHWYTVSNVVI-PSHSG 109

  Fly   108 YNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEG--SEVIVAGWGRTSDGTNSYKIRQISL 170
            ..|..::.::.||..:.|.|.:..|.:..:...|....  .....:.|...:....:..:.|:| 
  Fly   110 KRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAWLSKNKNPQTIVLSQLS- 173

  Fly   171 KVAPEATC-LDAYSDHDEQSFCLAHELKEGTCHGDGG---------GGAIYGNTLIGLTNFVVGA 225
                ...| |:...:...:..|.|...:..:|..|.|         |..|....|.|:..:|.|.
  Fly   174 ----RDRCKLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGR 234

  Fly   226 CGSRYPDVFVRLSSYADWIQ 245
            .....|.:::.::....||:
  Fly   235 SWCSEPAIYIDVAECVGWIE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 43/215 (20%)
Tryp_SPc 42..244 CDD:214473 41/212 (19%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 43/215 (20%)
Tryp_SPc 46..253 CDD:214473 41/212 (19%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.