DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and LOC101730792

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_031762443.1 Gene:LOC101730792 / 101730792 -ID:- Length:146 Species:Xenopus tropicalis


Alignment Length:140 Identity:37/140 - (26%)
Similarity:63/140 - (45%) Gaps:7/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 AVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRTS--DGTNSYKIRQISLKVAPEAT 177
            |::.|:....|...::.:||...|.: |.||....|:|||.||  .|..|..:|.:.|.:.|...
 Frog     7 ALLPLNRPAFYNAFVSVVPLPIQGVS-PIEGRLCQVSGWGFTSTIGGKPSDTLRSVKLPIVPMRK 70

  Fly   178 CLD--AYSDHDEQSFCLAHELKEG--TCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLS 238
            |..  :|:.|...:...|..:..|  .|.||.||..:....:.|:.::.......:||.|:..::
 Frog    71 CNSSASYAGHITSNMICAGFITGGKDACQGDSGGPLVCDGKVYGVVSWGHSCANPKYPGVYTAVA 135

  Fly   239 SYADWIQEQI 248
            ::..||...|
 Frog   136 NFQRWIYRTI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 36/137 (26%)
Tryp_SPc 42..244 CDD:214473 34/134 (25%)
LOC101730792XP_031762443.1 Tryp_SPc <7..141 CDD:214473 34/134 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.