DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Gm2663

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:248 Identity:62/248 - (25%)
Similarity:112/248 - (45%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLID 76
            :|.......::..:|:||......:..:..||....:|.||||:::...:|:.|||..|      
Mouse    10 LGAAVALPANSDDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLINDQWVLSAAHCYKR------ 68

  Fly    77 ASRLACRVGSTN---QYAGGKIVNVESVAVHPDYY--NLNNNLAVITLSSELTYTDRITAIPLVA 136
              ||..|:|..|   ...|.:.::.|.:..||||.  .::|::.:|.|.|......:::.:.|..
Mouse    69 --RLQVRLGEHNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILNSQVSTVSLPR 131

  Fly   137 SGEALPAEGSEVIVAGWGRTSDGTNSYK--IRQISLKVAPEATCLDAYSDH-DEQSFCLAH-ELK 197
            |   ..:..::.:|:|||.|......|.  ::.:...|...::|..:|... ....|||.. |..
Mouse   132 S---CASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGG 193

  Fly   198 EGTCHGDGGGGAIYGNTLIGLTNFVVGACGSR-YPDVFVRLSSYADWIQEQIA 249
            :.:|.||.||..:....:.|:.:: ...|..| .|.|:.::.:|..||||.:|
Mouse   194 KDSCDGDSGGPVVCNGEIQGIVSW-GSVCAMRGKPGVYTKVCNYLSWIQETMA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 56/214 (26%)
Tryp_SPc 42..244 CDD:214473 53/211 (25%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 56/228 (25%)
Tryp_SPc 24..243 CDD:238113 59/230 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.