DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and prss60.1

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:266 Identity:88/266 - (33%)
Similarity:132/266 - (49%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLAQ-NDSVVEP---RIVGGTKAREGQFPHQISLRR--RGSHTCGGSIISKDYVVTAA 67
            |:||..|..:| |...:.|   |||||..|.:|.:|.|:||..  .|.|.||||:|:.::|:|||
Zfish    11 LLLCVQGSHSQLNVCGLAPLNNRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLINSEWVLTAA 75

  Fly    68 HCVKQGNNVAPANELEIQAGSLLLSSG-----GVRV-----PVATVTVHPNYN--SNGHDVAVLR 120
            ||:.:           |...|||:..|     ||..     .|:.:||||:||  :|.:|:|:|.
Zfish    76 HCLPR-----------ITTSSLLVFLGKTTQQGVNTYEINRTVSVITVHPSYNNLTNENDIALLH 129

  Fly   121 LRNSLTFNSNIAAIKLATEDP--PNDATVDISGWGAISQRG---PISNSLLYVQVKALSRESCQK 180
            |.:::||::.|..:.||.::.  ||..:..|:|||.| |.|   |....|....:..:..:.|..
Zfish   130 LSSAVTFSNYIRPVCLAAQNSVFPNGTSSWITGWGNI-QLGVNLPAPGILQETMIPVVPNDQCNA 193

  Fly   181 TY-LRQLPETTMCL-LHPKDKGACYGDSGGPATYQGKLV----GLASFVIGGCGRAAPDGYERVS 239
            .. ...:....:|. |....:..|.||||||...:..||    |:.|:..|.....:|..|.|||
Zfish   194 LLGSGSVTNNMICAGLLQGGRDTCQGDSGGPMVSKQCLVWVQSGITSWGYGCADPYSPGVYTRVS 258

  Fly   240 KLRNWI 245
            :.::||
Zfish   259 QYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 79/242 (33%)
Tryp_SPc 28..248 CDD:238113 80/243 (33%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 79/242 (33%)
Tryp_SPc 34..267 CDD:238113 80/243 (33%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.