DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and gzma

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:227 Identity:65/227 - (28%)
Similarity:101/227 - (44%) Gaps:19/227 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLS 92
            ||||...::. ....:|::...:|.|||.:|.|::|:|||||.:..     .:.:.:..|||.||
Zfish    28 IVGGKDVKKA-LSWMVSIQVNQNHKCGGILIHKEWVLTAAHCKEDS-----YSSVTVLIGSLSLS 86

  Fly    93 SGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWGAISQ 157
            .|..|:.:....:...:|.......::.:|.|....:....|....:|........:.|||....
Zfish    87 KGSQRIAIHNYEIPETFNKKTKKDDIMLIRLSKKVKAKPYKIPKKEKDVQPGTKCVVRGWGTTDY 151

  Fly   158 RG-PISNSLLYVQVKALSRESCQKTYLRQLPETTMCLL----HPKDKGACYGDSGGPATYQGKLV 217
            :| ..|:.|..::|..:.|..|.:.|.|. |..|..:|    ..:.:|.|.||||||...:..||
Zfish   152 KGKQASDKLQMLEVLVVDRVQCNRYYNRN-PVITKDMLCAGNTQQHRGTCLGDSGGPLECEKNLV 215

  Fly   218 GLASFVIG--GCG-RAAPDGYERVSKLR-NWI 245
            |:.|   |  ||| ...|..|..:||.. .||
Zfish   216 GVLS---GSHGCGDPKKPTVYTLLSKRHITWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 63/225 (28%)
Tryp_SPc 28..248 CDD:238113 65/227 (29%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 65/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587686
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.