DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and gzmk

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_017208551.1 Gene:gzmk / 794999 ZFINID:ZDB-GENE-091204-352 Length:267 Species:Danio rerio


Alignment Length:227 Identity:64/227 - (28%)
Similarity:104/227 - (45%) Gaps:19/227 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLS 92
            ||||...::. ....:|:::...|.|||.:|.|.:|:|:|.|.:     .|.:.:.:..|||.||
Zfish    38 IVGGKDVKKA-LSWMVSIQKEKIHICGGILIHKQWVLTSAQCKE-----VPVSSVTVLIGSLSLS 96

  Fly    93 SGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWGAISQ 157
            .|..|:.:....:...:|....:..::.:|.|....:....|....:|.|......:.|||....
Zfish    97 KGSQRIGILNYEIPKTFNEKTKEDDIMLIRLSKKVKAKPYKIPKNEKDVPPGTKCVVRGWGTTDY 161

  Fly   158 RG-PISNSLLYVQVKALSRESCQKTYLRQLPETTMCLL----HPKDKGACYGDSGGPATYQGKLV 217
            :. ..|:.|..::|..:.|:.|.:.|.|. |..|..:|    ..:.:|.|:||||||...:..||
Zfish   162 KDEQASDKLQMLEVLVVDRDQCNRYYNRN-PVITKDMLCAGNTQQHRGTCWGDSGGPLECKKNLV 225

  Fly   218 GLASFVIG--GCG-RAAPDGYERVSKLR-NWI 245
            |:.|   |  ||| ...|..|..:||.. :||
Zfish   226 GVIS---GSQGCGIPKKPTVYTFLSKRHISWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 62/225 (28%)
Tryp_SPc 28..248 CDD:238113 64/227 (28%)
gzmkXP_017208551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.