DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and zgc:153968

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:270 Identity:82/270 - (30%)
Similarity:130/270 - (48%) Gaps:35/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLAQNDS------------VVEPRIVGGTKAREGQFPHQISLR--RRGSHTCGGSIIS 59
            |.:|.||||..|.|            .::|||:||..|..|.:|.|:|:.  ..|...|||::|:
Zfish     5 LAVCVAGVLLLNISGSLCQLDVCGRAPLKPRIIGGQTAMAGSWPWQVSIHYIPTGGLLCGGTLIN 69

  Fly    60 KDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRV---PVATVTVHPNYNS--NGHDVAVL 119
            :::|::||.|.::    ..|:.|.:..|.  ||:|...|   |.:.:..||.|:|  |.:|:|:|
Zfish    70 REWVLSAAQCFQK----LTASNLVVHLGH--LSTGDPNVIHNPASQIINHPKYDSATNKNDIALL 128

  Fly   120 RLRNSLTFNSNIAAIKLATEDPP--NDATVDISGWGAISQRG-PISNSLLYVQVKALSRESCQKT 181
            :|...::|...|..:.|......  ..|...|:|||:|:..| ....:|..|::..:|...|:..
Zfish   129 KLSTPVSFTDYIKPVCLTASGSSLGKGAVSWITGWGSINTGGTQFPTTLQEVKIPVVSNGDCKSA 193

  Fly   182 YLRQLPETTMCLLHPKD--KGACYGDSGGPATY----QGKLVGLASFVIGGCGRAAPDGYERVSK 240
            |...:.:..:| ..|.:  ||.|.||.|||..:    |....|:|||..|......|..:.|||:
Zfish   194 YGSLITDGMIC-AGPNEGGKGICMGDGGGPLVHNSSEQWIQSGIASFGRGCAQPKNPGVFTRVSE 257

  Fly   241 LRNWIAEKAS 250
            ..:||..:.|
Zfish   258 YESWIKSQIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 70/233 (30%)
Tryp_SPc 28..248 CDD:238113 71/235 (30%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 70/233 (30%)
Tryp_SPc 36..265 CDD:238113 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587704
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.