DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss8

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:266 Identity:89/266 - (33%)
Similarity:136/266 - (51%) Gaps:32/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQN-----DSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAA 67
            ||.|..:|:.|..     .:|::|||.||..|:.||:|.|:|:...|:|.||||::|..:||:||
Mouse    20 LLGLLQSGIRADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSNKWVVSAA 84

  Fly    68 HCVKQGNNVAPANELEIQAGSL-LLSSGGVRVPVATVTVHPNYNSNGH--DVAVLRLRNSLTFNS 129
            ||..:.:: ..|.|:::.|..| ..|:..|...||.:..|.:|...|.  |:|::||.:.:||:.
Mouse    85 HCFPREHS-REAYEVKLGAHQLDSYSNDTVVHTVAQIITHSSYREEGSQGDIALIRLSSPVTFSR 148

  Fly   130 NIAAIKL--ATEDPPNDATVDISGWG----AISQRGPISNSLLYVQVKALSRESCQKTY-LRQLP 187
            .|..|.|  |....||.....::|||    ::|.:.|  ..|..::|..:|||:|...| :..:|
Mouse   149 YIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTP--RPLQQLEVPLISRETCSCLYNINAVP 211

  Fly   188 E-------TTMCLLHPK-DKGACYGDSGGPAT--YQG--KLVGLASFVIGGCGRA-APDGYERVS 239
            |       ..:|..:.| .|.||.||||||.:  .:|  .|.|:.|:. ..||.. .|..|...|
Mouse   212 EEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWG-DACGAPNRPGVYTLTS 275

  Fly   240 KLRNWI 245
            ...:||
Mouse   276 TYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 80/240 (33%)
Tryp_SPc 28..248 CDD:238113 81/241 (34%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 81/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.