DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and TPSAB1

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:267 Identity:79/267 - (29%)
Similarity:124/267 - (46%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLAQ--------NDSVVEPRIVGGTKAREGQFPHQISLRRRG---SHTCGGSIISKDY 62
            |:|.|..|||.        ..::....||||.:|...::|.|:|||..|   .|.||||:|...:
Human     4 LLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQW 68

  Fly    63 VVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSL 125
            |:||||||  |.:|.....|.:|.....|......:||:.:.|||.:.:.  |.|:|:|.|...:
Human    69 VLTAAHCV--GPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPV 131

  Fly   126 TFNSNIAAIKL--ATEDPPNDATVDISGWGAI--SQRGPISNSLLYVQVKALSRESCQKTY---- 182
            ..:|::..:.|  |:|..|......::|||.:  .:|.|....|..|:|..:....|...|    
Human   132 NVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGA 196

  Fly   183 -----LRQLPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIG---GCGRA-APDGYERV 238
                 :|.:.:..:|..:.: :.:|.||||||...:.....|.:.|:.   ||.:. .|..|.||
Human   197 YTGDDVRIVRDDMLCAGNTR-RDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRV 260

  Fly   239 SKLRNWI 245
            :...:||
Human   261 TYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/239 (30%)
Tryp_SPc 28..248 CDD:238113 73/240 (30%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 73/240 (30%)
Tryp_SPc 31..267 CDD:214473 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.