DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and prss1

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:248 Identity:77/248 - (31%)
Similarity:121/248 - (48%) Gaps:24/248 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK 71
            :|..:..|..|..:|.    :||||.:..:...|:|:|| ..|.|.||||:||..:||:||||.|
Zfish     8 ALFAVAYAAPLGDDDD----KIVGGYECTKNGVPYQVSL-NSGYHFCGGSLISNLWVVSAAHCYK 67

  Fly    72 QGNNVAPANELEIQAG--SLLLSSGGVR-VPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNI 131
                    :.::::.|  ::.::.|..: :....|..||:||||  .:||.:::|.:|...||.:
Zfish    68 --------SRVQVRLGEHNIDVTEGTEQFINSEKVIRHPSYNSNTLDNDVMLIKLSSSAQINSYV 124

  Fly   132 AAIKLATEDPPNDATVDISGWGAISQRGPISN---SLLYVQVKALSRESCQKTYLRQLPETTMCL 193
            ..:.|.:....:..:..|||||.:|..|  ||   .|:.:....||..:|:..|..|:.....|.
Zfish   125 KTVSLPSSCASSGTSCLISGWGNMSASG--SNYPSRLMCLNAPILSDSTCRNAYPGQISSNMFCA 187

  Fly   194 -LHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
             .....|.:|.||||||.....:|.|:.|:..|...|..|..|.:|.....||
Zfish   188 GFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVCNFTTWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/226 (31%)
Tryp_SPc 28..248 CDD:238113 73/227 (32%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 71/226 (31%)
Tryp_SPc 25..243 CDD:238113 73/227 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.