DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and zgc:123295

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:271 Identity:91/271 - (33%)
Similarity:137/271 - (50%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TSLLVLCA-----AGVLAQ----NDSVVEPRIVGGTKAREGQFPHQISLR--RRGSHTCGGSIIS 59
            |:|.|:.|     ||.|.|    ..:.:..:||||..|..|.:|.|:||:  ..|.|.||||:|:
Zfish     5 TALTVVGALLVNIAGSLCQLNVCGRAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLIN 69

  Fly    60 KDYVVTAAHC---------VKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNG 113
            ||:|::||||         ||.|        |:.|:||   :...:...|..|..|||||  ||.
Zfish    70 KDWVLSAAHCFQDSIGTIMVKLG--------LQSQSGS---NPYQITKTVVQVINHPNYNNPSND 123

  Fly   114 HDVAVLRLRNSLTFNSNIAAIKLATEDPPNDA-TVD-ISGWGAISQ-RGPISNSLLYVQVKALSR 175
            :|:|:::|.:|:|||..|..:.||.......| |:. ::|||.:|. ...|.:.|..|::..:|.
Zfish   124 NDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSH 188

  Fly   176 ESCQKTYLRQLPETTMC--LLHPKDKGACYGDSGGPATYQGKLVGLASFVIG---GCGRAA-PDG 234
            ..|::.|..::....:|  ||....|.:|.||||||...:.....:.|.::.   ||.... |..
Zfish   189 SDCKRAYPGEITSNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGV 253

  Fly   235 YERVSKLRNWI 245
            |.|||:.::||
Zfish   254 YARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 81/239 (34%)
Tryp_SPc 28..248 CDD:238113 83/240 (35%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 81/239 (34%)
Tryp_SPc 36..264 CDD:238113 81/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.