DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG17242

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:274 Identity:71/274 - (25%)
Similarity:111/274 - (40%) Gaps:72/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSV-VEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK 71
            ||::..|.:.|...|: :|            |.|.|.|::....|.|||.|.|:|.::|.|.||:
  Fly     7 LLLVSIAQIAADFKSIGIE------------QAPWQASVQINDKHHCGGVIYSEDIILTIAECVR 59

  Fly    72 QGNNVAPANELEIQAGSLLLSSGGV-----RVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNI 131
            :    |....:.::.||...::||.     ::.:..:.:.|:      |||:|:||:.|..:..|
  Fly    60 K----ARLEFISVRVGSAQENAGGTVLKVEKMRLQVLGLRPS------DVAILQLRSPLYLDGGI 114

  Fly   132 AAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHP 196
            .||.|||..........:||||.:|...|.|..||.|.||              :.:..||..:.
  Fly   115 RAIPLATIPLVPGTNASVSGWGQLSAMNPSSEVLLRVDVK--------------IQDQLMCATNL 165

  Fly   197 KDKG------------------ACYGDSGGPATYQGKLVGLASFVIGGCGRAAPD------GYER 237
            ..||                  ||.|..|||.....:|.|:.|:      ::|.|      .|..
  Fly   166 ALKGRLMSVGEICAAPAGEIPYACQGFVGGPLVANNRLYGILSW------QSACDVLNKSSVYAN 224

  Fly   238 VSKLRNWIAEKASL 251
            ::..:.||.....|
  Fly   225 IAMFKVWIESTVKL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 62/246 (25%)
Tryp_SPc 28..248 CDD:238113 64/248 (26%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 65/252 (26%)
Tryp_SPc 24..232 CDD:214473 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.