DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG17234

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:262 Identity:89/262 - (33%)
Similarity:124/262 - (47%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWTSLLVLCAAGVLAQND-SVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAA 67
            |..|.|:|.|...|:... :..|.||:||......|.|.|:||:..|.|.|||||.|::.:||||
  Fly     2 FIESFLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAA 66

  Fly    68 HCV--KQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNY--NSNGHDVAVLRLRNSLTFN 128
            ||.  ::||.:.... .:::|||.|..|.|..|.||.:.:|..|  :.|.:|:|::||...|.|.
  Fly    67 HCFFDEEGNRLDDQG-YQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFT 130

  Fly   129 SNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLY---VQVKALSRES------------C 178
            |.:..|.||..:|...:...:||||........:|  ||   :|..||..:|            |
  Fly   131 SKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTN--LYPTHLQGLALHIKSIFSCRLFDPSLLC 193

  Fly   179 QKTYLRQLPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRN 243
            ..||.|.               ||:||||||.....:|||:.|:...||..:|  .:..|...|.
  Fly   194 AGTYGRT---------------ACHGDSGGPLVVNKQLVGVVSWGRKGCVSSA--FFVSVPYFRE 241

  Fly   244 WI 245
            ||
  Fly   242 WI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 80/236 (34%)
Tryp_SPc 28..248 CDD:238113 81/237 (34%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 80/236 (34%)
Tryp_SPc 27..243 CDD:238113 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.