DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG17239

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:242 Identity:80/242 - (33%)
Similarity:123/242 - (50%) Gaps:16/242 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGN 74
            :..|..|...:.:.:..|||||........|.|.|:.|.|...||.:|.|:|.|:|||||:..  
  Fly     6 IFLAFSVTVVSSNWIPERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTD-- 68

  Fly    75 NVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN-GHDVAVLRLRNSLTFNSNIAAIKLAT 138
              .....|.::.||.....||..|.|::|.:|..|:.: .:|:||:||::.|...|.::.|.||.
  Fly    69 --RETEFLSVRVGSSFTFFGGQVVRVSSVLLHEEYDQSWSNDIAVMRLQSKLRLGSAVSVIPLAD 131

  Fly   139 EDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGACY 203
            ..|.:.:...:||||||..:.....|:|...|..:.::.|:::|.|::.:..:|...| .|.||.
  Fly   132 TPPASGSPATVSGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAP-GKDACS 195

  Fly   204 GDSGGPATYQGKLVGLASFVIGGCGRAA-----PDGYERVSKLRNWI 245
            ||||||.....||||:.||     |:..     |..|..|::|:.||
  Fly   196 GDSGGPLVSGNKLVGIVSF-----GKECAHPEYPGVYANVAELKPWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 76/223 (34%)
Tryp_SPc 28..248 CDD:238113 77/224 (34%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 76/223 (34%)
Tryp_SPc 24..237 CDD:238113 75/222 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.