DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG18735

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:254 Identity:73/254 - (28%)
Similarity:120/254 - (47%) Gaps:55/254 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCV----------------KQGNN 75
            |||||.:....::|..|.|...|:..||.|:::..|.:||||||                :|.::
  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146

  Fly    76 VAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKLAT 138
            |...:.                 .|:.|.:||.|::..  .|:|::|....:....::..:.:.|
  Fly   147 VKIVDR-----------------RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPT 194

  Fly   139 EDPPND----ATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYL--RQLPETTMC--LLH 195
               |::    .|..::||||:|:.||||::|..|:|..||:|.|:.:..  .::.:..:|  .:.
  Fly   195 ---PSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVE 256

  Fly   196 PKDKGACYGDSGGPATYQG-----KLVGLASFVIG-GCGRA-APDGYERVSKLRNWIAE 247
            ...|.:|.||||||....|     :|.|:.|:  | ||.:. ||..|.||....:||||
  Fly   257 QGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSW--GEGCAKPNAPGVYTRVGSFNDWIAE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/250 (28%)
Tryp_SPc 28..248 CDD:238113 72/253 (28%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 69/250 (28%)
Tryp_SPc 83..314 CDD:238113 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457773
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.