DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG34458

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:252 Identity:95/252 - (37%)
Similarity:137/252 - (54%) Gaps:12/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK 71
            |:|:|....|.:..|...|.||:||..|..||||||:||:..|.|.||||:||...:||||||. 
  Fly    11 SILLLAVTFVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCT- 74

  Fly    72 QGNNVAPANELEIQAGSLLLSSG-GVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAA 133
            .|.|   ..:::...|:..||:| |....:|...:||.||  |...|:::::|.:.:.....:..
  Fly    75 MGQN---PGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQT 136

  Fly   134 IKLATEDP--PNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHP 196
            |:||..|.  ..|....|||:|||:|...:.|.|.:.||:..||:.|....:..|.:..:|..||
  Fly   137 IQLADSDSNYAADTMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPGLTDRMVCAGHP 201

  Fly   197 KDK-GACYGDSGGPATYQGKLVGLASFVIGGCG-RAAPDGYERVSKLRNWIAEKASL 251
            ..: .:|.||||||.|..|||.|:.|:.. ||| :..|..|..|..||:||.:.|::
  Fly   202 SGQVSSCQGDSGGPLTVDGKLFGVVSWGF-GCGAKGRPAMYTYVGALRSWIKQNANV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 86/224 (38%)
Tryp_SPc 28..248 CDD:238113 87/226 (38%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 86/224 (38%)
Tryp_SPc 32..254 CDD:238113 87/226 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.