DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG34290

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:283 Identity:71/283 - (25%)
Similarity:114/283 - (40%) Gaps:68/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLR-------RRG---SHTCGGSII 58
            |..|:|..|.|      ..:|..|||....:...::|..:||:       ..|   .|.||||:|
  Fly    21 FIISVLESCHA------VPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLI 79

  Fly    59 SKDYVVTAAHCVKQGN-----------NVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNY--- 109
            |..::::|||||.:.|           |:....:|:               |....:|...|   
  Fly    80 SDRWILSAAHCVWRKNIHYIAAFIGYENIENIGQLQ---------------PYGLESVEYIYFQP 129

  Fly   110 NSNGHDVAVLRLRNSL--TFNSNIAAIKLATEDPPNDATVD------ISGWGAISQRGPISNSLL 166
            ::..:|:|:|.::...  .|.:.:...:|    ||:....|      |.|:||....||....|.
  Fly   130 SNFRNDIALLYMKRRYWSDFGNGLQYAQL----PPHGMKPDQNESCRIIGYGATHHAGPCQKRLF 190

  Fly   167 YVQVKALSRESCQ----KTYLRQLPETTMCLLHPKDKGACYGDSGGP--ATYQGK--LVGLASFV 223
            ..:|:.:..:.|:    ..:..|....|:|.| ..::.:|.||||||  .||.||  :.||.|..
  Fly   191 EAEVRVIDNQKCRDIIGHIWAPQNGANTVCAL-GNNQDSCQGDSGGPLICTYGGKDYIYGLVSHG 254

  Fly   224 IGGCG-RAAPDGYERVSKLRNWI 245
            : .|| ...|..|.......:|:
  Fly   255 L-TCGIPGMPSIYTVTRPYYDWV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 64/258 (25%)
Tryp_SPc 28..248 CDD:238113 64/259 (25%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 66/264 (25%)
Tryp_SPc 34..276 CDD:214473 65/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.