DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:81 Identity:27/81 - (33%)
Similarity:35/81 - (43%) Gaps:5/81 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 VKALSRESCQKTYLRQLPETTMCL-LHPKDKGACYGDSGGPATYQGKLVGLASFVIG---GCGRA 230
            |..:....|.......:.:..||. |....|..|.||||||...|...|.:.|.:|.   .||:.
Zfish    21 VPVVINSDCNNLLGATITDNMMCAGLLQGGKDTCQGDSGGPMVSQQCSVWVQSGIISKGHDCGQP 85

  Fly   231 -APDGYERVSKLRNWI 245
             .|..|.|||:.:|||
Zfish    86 YEPGVYTRVSQYQNWI 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 25/79 (32%)
Tryp_SPc 28..248 CDD:238113 27/81 (33%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 27/81 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.