DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP001245

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001689377.2 Gene:AgaP_AGAP001245 / 5667668 VectorBaseID:AGAP001245 Length:272 Species:Anopheles gambiae


Alignment Length:273 Identity:84/273 - (30%)
Similarity:125/273 - (45%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSVV-----------------------EPRIVGGTKAREGQFPHQISLRRRG 49
            :|.|.||||.|..:..|                       :.||.||.:|....:|:|:|| ||.
Mosquito     6 VLALFAAGVAALTEEEVWLQYNRRMPGEYYTKGLVELPPFQGRIFGGVEADIANYPYQLSL-RRA 69

  Fly    50 SHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNG- 113
            ||:||.|:||.::.::||||...   |.....:.:|.||...:||||...|..:..||.|:... 
Mosquito    70 SHSCGASVISANWALSAAHCTFP---VPAPGVITLQGGSSDRTSGGVVFQVEQIINHPQYDDWNL 131

  Fly   114 -HDVAVLRLRNSLTFNSNIAAIKLATEDPPN-----DATVDISGWGAISQRGPISNSLL-YVQVK 171
             :||.|||....|: ..|||.|.|   ||..     .:...:||||.:  .|.:..::| .|.:.
Mosquito   132 VNDVCVLRTTTPLS-GVNIAIIAL---DPVGATHAVGSRAVLSGWGLM--EGSVLPAILRRVDIP 190

  Fly   172 ALSRESCQKTYLRQLPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYE 236
            .:.:.:|:..:........|.......:.||.||||||....|:.:|:.|:....|....|..:.
Mosquito   191 VVDQGACETAWGSGWVTPDMICASEPGRDACNGDSGGPLVVGGQQIGIVSWGDTQCVGTRPGVFA 255

  Fly   237 RVS--KLRNWIAE 247
            ||:  .:|||||:
Mosquito   256 RVAFPLIRNWIAQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 73/227 (32%)
Tryp_SPc 28..248 CDD:238113 75/230 (33%)
AgaP_AGAP001245XP_001689377.2 Tryp_SPc 48..266 CDD:214473 73/227 (32%)
Tryp_SPc 49..269 CDD:238113 75/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.