DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP001251

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001689373.2 Gene:AgaP_AGAP001251 / 5667665 VectorBaseID:AGAP001251 Length:290 Species:Anopheles gambiae


Alignment Length:228 Identity:68/228 - (29%)
Similarity:111/228 - (48%) Gaps:21/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELE 83
            |:.:|..|.|.||.......:|:|:|||..|:|.||.|:|::.:.::||||:.:.  :.| :.:.
Mosquito    55 QDLNVPSPFIFGGESVAIESYPYQLSLRLEGTHICGASVIAERWALSAAHCLDEA--LYP-SAIT 116

  Fly    84 IQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAIKLATEDP--PND 144
            .:.|:....:||.........:||.::..  .:||:|..:|.|. |...|.|:.||..:.  |..
Mosquito   117 FRGGTPHRLAGGYIFHAEYYLLHPKFDRRTLDYDVSVTHVRESF-FIDPIRAVTLANTNTYYPIP 180

  Fly   145 ATVDISGWGAISQRG--P-ISNSL-LYVQVKALSRESCQKTYLRQLPETTMC---LLHPKDKGAC 202
            :...::|||.....|  | |..|| :|:|.|    :.|..:.:..|.:..:|   .::.|:  .|
Mosquito   181 SAAVVTGWGLADADGYEPLILQSLEIYLQQK----QFCWTSTIEALTDRQICGGSGVYGKE--TC 239

  Fly   203 YGDSGGPATYQGKLVGLASFVIGGCGRAAPDGY 235
            |||||||....|..||:.|:....|....|..|
Mosquito   240 YGDSGGPLVMNGYQVGIVSWGSDNCAVNIPGIY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 65/220 (30%)
Tryp_SPc 28..248 CDD:238113 65/219 (30%)
AgaP_AGAP001251XP_001689373.2 Tryp_SPc 64..277 CDD:214473 65/219 (30%)
Tryp_SPc 64..277 CDD:238113 65/219 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.