DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP001250

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001689374.2 Gene:AgaP_AGAP001250 / 5667664 VectorBaseID:AGAP001250 Length:279 Species:Anopheles gambiae


Alignment Length:232 Identity:70/232 - (30%)
Similarity:117/232 - (50%) Gaps:12/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91
            |||||..|....||:|:||||.|.|.||.|:||..:.::||||...   :...||:.::|||...
Mosquito    53 RIVGGRDAPIENFPYQLSLRRSGVHACGASVISLRWALSAAHCTYP---IPQMNEMSLRAGSSNR 114

  Fly    92 SSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKL--ATEDPPNDATVDISGW 152
            .:||..:|:..:..||.::  :..:||.||:....:. ...|..:.|  ||.........:.:||
Mosquito   115 LAGGTIIPITQIINHPLFSEYTIEYDVCVLQTSTEMV-GQFIVPVVLPPATSGFAPGTMANATGW 178

  Fly   153 GAISQRGPISNSLLYVQVKALSRESCQKTYLRQ-LPETTMCLLHPKDKGACYGDSGGPATYQGKL 216
            |.::..|.:...|.||.:..:|.:.|:.::..: :.|..:|...| .:..|.||||||....|..
Mosquito   179 GLLNVPGSLPVQLQYVALPLISLDQCRNSWPSEWITEEMLCAGQP-GRDTCGGDSGGPLVINGYQ 242

  Fly   217 VGLASFVIGGCGRAAPDGYERVSK--LRNWIAEKASL 251
            :|:||:.:..|....|..:...:.  :|::|.|:..:
Mosquito   243 MGIASWGVSECSGNLPSVFANTANPTVRSFILERTGV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 68/224 (30%)
Tryp_SPc 28..248 CDD:238113 68/226 (30%)
AgaP_AGAP001250XP_001689374.2 Tryp_SPc 53..273 CDD:214473 68/224 (30%)
Tryp_SPc 54..273 CDD:238113 67/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.