DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:252 Identity:83/252 - (32%)
Similarity:126/252 - (50%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CAAG------VLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCV 70
            |.:|      .||...|:..||:||..:|....:|.|:|::....|.|||||:...:|:|||||.
Human   183 CLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCF 247

  Fly    71 KQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTV---HPNYNSNGHDVAVLRLRNSLTFNSNIA 132
            ::..:|.   ..:::|||..|.| ...:.||.:.:   :|.|..: :|:|:::|:..|||:..:.
Human   248 RKHTDVF---NWKVRAGSDKLGS-FPSLAVAKIIIIEFNPMYPKD-NDIALMKLQFPLTFSGTVR 307

  Fly   133 AIKLATEDPP-NDAT-VDISGWGAISQR-GPISNSLLYVQVKALSRESC--QKTYLRQLPETTMC 192
            .|.|...|.. ..|| :.|.|||...|. |.:|:.||...|:.:....|  ...|..::.|..||
Human   308 PICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMC 372

  Fly   193 LLHPK-DKGACYGDSGGPATYQG---KLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            ...|: ....|.||||||..||.   .:||:.|:..|..|.:.|..|.:||...|||
Human   373 AGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 75/229 (33%)
Tryp_SPc 28..248 CDD:238113 76/230 (33%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335 4/13 (31%)
Tryp_SPc 204..429 CDD:214473 75/229 (33%)
Tryp_SPc 205..432 CDD:238113 76/230 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.