DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and PRTN3

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:255 Identity:75/255 - (29%)
Similarity:125/255 - (49%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRR---GSHTCGGSIISKDYVVTAAHC 69
            ||.|..:|.....:      ||||.:|:....|:..||:.|   |||.|||::|...:|:|||||
Human    14 LLALLLSGAARAAE------IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHC 72

  Fly    70 VKQGNNVAPANELEIQAGSLLLSSGGVRV--------PVATVTVHPNYNSNG--HDVAVLRLRNS 124
            ::         ::..:..:::|.:..||.        .||.|.:: ||::..  :||.:::|.:.
Human    73 LR---------DIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLN-NYDAENKLNDVLLIQLSSP 127

  Fly   125 LTFNSNIAAIKLATEDP--PNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLP 187
            ...::::|.::|..:|.  |:.......|||.:....|.:..|..:.|..:       |:..: |
Human   128 ANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVV-------TFFCR-P 184

  Fly   188 ETTMCLLHPKDK-GACYGDSGGPATYQGKLVGLASFVIGGCG-RAAPDGYERVSKLRNWI 245
            . .:|...|:.| |.|:||||||....|.:.|:.||||.||. |..||.:.||:...:||
Human   185 H-NICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/234 (29%)
Tryp_SPc 28..248 CDD:238113 71/235 (30%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.