DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:230 Identity:68/230 - (29%)
Similarity:105/230 - (45%) Gaps:20/230 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSL 89
            :.||:||.:.:.....:|.|::....|.|||::|...:||:||||.:      |:..:::.....
Zfish    21 QQRIIGGQEVQPYSIKYQASVQYNNYHYCGGTLIHPQWVVSAAHCWR------PSYLIKVVLSEH 79

  Fly    90 LLS--SGGVRV-PVATVTVH--PNYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPP-NDATVD 148
            .||  .|..|| .|:...||  .||.:...|:.:|:|......::.|....|....|. ...||.
Zfish    80 DLSKIEGFERVFNVSKALVHYMYNYRTFDSDIMLLKLEKPAELSATIQPAVLPVSVPALQGGTVC 144

  Fly   149 I-SGWGAISQRG-PISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHP-KDKGACYGDSGGPA 210
            | ||||...... .:|..|..|.|:.:.:  ||..|..::.:..:|...| ..|.:|.||||||.
Zfish   145 IVSGWGVTQVYSYYLSPVLRAVDVQIIPQ--CQYYYYYRITDNMVCAGSPLGGKDSCQGDSGGPL 207

  Fly   211 TYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            ...|...|:.|:.|.......|..|   :|:||:|
Zfish   208 ICNGYFEGIVSWGISCANAYFPGVY---TKVRNYI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/226 (30%)
Tryp_SPc 28..248 CDD:238113 67/227 (30%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 68/228 (30%)
Tryp_SPc 24..241 CDD:238113 67/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.