DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and tmprss9

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_021325244.1 Gene:tmprss9 / 562051 ZFINID:ZDB-GENE-050208-573 Length:788 Species:Danio rerio


Alignment Length:255 Identity:83/255 - (32%)
Similarity:129/255 - (50%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNN- 75
            |:.|    ...|:..|||||...|.|:||.|:|||.||.||||.||::..::|:||||.:..|| 
Zfish   220 CSCG----TRPVMSNRIVGGENTRHGEFPWQVSLRLRGRHTCGASIVNSRWLVSAAHCFEVENNP 280

  Fly    76 -----VAPANELE-IQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIA 132
                 :..||::. .:|.:.:       |.:.::.:.|.|:  :...||.||.|...|.|:..:.
Zfish   281 KDWTALVGANQVSGAEAEAFI-------VNIKSLVMSPKYDPMTTDSDVTVLELETPLKFSHYVQ 338

  Fly   133 AIKLATED---PPNDATVDISGWGAISQ-RGPISNSLLYVQVKALSRESCQKT--YLRQLPETTM 191
            .:.:.:..   .|....: :|||||::| ...:.::|....||.:..:.|.|:  |...|.:..|
Zfish   339 PVCIPSSSHVFTPGQNCI-VSGWGALNQYTTEVPSTLQKAIVKIIDSKVCNKSSVYRGALTQNMM 402

  Fly   192 CLLHPKDK-GACYGDSGGPATYQ---GK--LVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            |....:.| .:|.||||||...:   |:  |.|:.|:.:|......|..|.||:||||||
Zfish   403 CAGFLQGKVDSCQGDSGGPLACEVAAGRYFLAGIVSWGVGCAQINKPGVYSRVTKLRNWI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 78/238 (33%)
Tryp_SPc 28..248 CDD:238113 79/239 (33%)
tmprss9XP_021325244.1 SEA 52..146 CDD:307516
LDLa 185..220 CDD:238060 83/255 (33%)
Tryp_SPc 232..462 CDD:238113 77/237 (32%)
LDLa 510..544 CDD:238060
Tryp_SPc 557..783 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.