DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and LOC560023

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:268 Identity:79/268 - (29%)
Similarity:122/268 - (45%) Gaps:38/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PFWTSLLVLCAAG---------VLA--QNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGS 56
            ||..::|...|||         |||  ..|:..: ||:||.:.......:|:||:....|.|||:
Zfish     9 PFRATILSRSAAGMAQLLWVFLVLAVMVRDAFSQ-RIIGGQEVVPYSIKYQVSLQVDRKHFCGGT 72

  Fly    57 IISKDYVVTAAHCVKQGNNVAPANELEI--QAGSLLLSSGGVRV-PVATVTVHPNYNSN--GHDV 116
            :|...:|:|||||.:      ||:.:::  ...:|.:..|..:| .||.|..|..||..  .:|:
Zfish    73 LIQPQWVLTAAHCWR------PASVIQVVLSEHNLAVEEGFEQVCTVAKVFSHVAYNPKTFNNDI 131

  Fly   117 AVLRLRNSLTFNSNIAAIKLATEDPP---NDATVDISGWGAISQRGPISNSLLYVQVKALSRE-- 176
            .:::|......|:.:....|.|.|.|   ..::..:||||...    :.|..|...::|:..|  
Zfish   132 MIIKLTAPAQINAYVQPALLPTADTPELAGGSSCTVSGWGVTR----LYNFYLSPILRAVDVEIF 192

  Fly   177 -SCQKTYLRQLPETTMCL---LHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYER 237
             |||..|..::.:..:|.   ...||  :|.||||||....|.|.|:.|:.||......|..|.:
Zfish   193 SSCQLYYYYRVNDNMICAGSRFGGKD--SCQGDSGGPLICDGYLEGIVSWGIGCALPYYPGVYTK 255

  Fly   238 VSKLRNWI 245
            |.....||
Zfish   256 VRNYNRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/231 (29%)
Tryp_SPc 28..248 CDD:238113 68/232 (29%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 67/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.