DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and zgc:112038

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:257 Identity:79/257 - (30%)
Similarity:124/257 - (48%) Gaps:20/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLAQNDSVVEPRI---VGGTKAREGQFPHQISLRRRG--SHTCGGSIISKDYVVTAAH 68
            |:|..||.|.|.|...:..:   .||..|..|.:|.|.|:.|..  .|.||||:|:||:|::|||
Zfish    13 LLLNIAGALCQLDVCGQAPLNNNNGGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAH 77

  Fly    69 C--VKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNS 129
            |  :....|:......:.|.||   :...:...:..:.:||:|:  :..:|:|:|||.:|:||..
Zfish    78 CFMITATANIKIFLGRQFQTGS---NPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTD 139

  Fly   130 NIAAIKLATEDP--PNDATVDISGWGA-ISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTM 191
            .|..:.||:.|.  .......|:||.. .|....::|.|..||:..:|...|...|...:.:..:
Zfish   140 YIRPVCLASADSVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNADYKGIITDNMI 204

  Fly   192 CL-LHPKDKGACYGDSGGPATYQGKLVGLASFVIG---GCGRAA-PDGYERVSKLRNWIAEK 248
            |. ::...|.||.||||||...|.....:.|.::.   .||... |..|.|||:.::||..:
Zfish   205 CAGINEGGKDACQGDSGGPMVSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITSE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 70/234 (30%)
Tryp_SPc 28..248 CDD:238113 72/236 (31%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 70/228 (31%)
Tryp_SPc 37..263 CDD:238113 70/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.