DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and cela1.1

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:267 Identity:79/267 - (29%)
Similarity:123/267 - (46%) Gaps:40/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQ---NDSVVEPRIVGGTKAREGQFPHQISLR----RRGSHTCGGSIISKDYVVT 65
            |.||.|.|:...   .|..:|.|::||..|:...:|.||||:    .|..|.|||::|...:|:.
Zfish     7 LSVLAAIGLTEPRYLEDLAIEERVIGGEIAKPHSWPWQISLQYQSGGRYHHYCGGTLIRPGWVMV 71

  Fly    66 AAHCVKQ--------GNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN----SNGHDVAV 118
            |||||..        |::....:|...|           .:.|..|.:|||:|    :||:|:|:
Zfish    72 AAHCVDTSRIWSVALGDHDTTTHEGPEQ-----------YISVKGVFIHPNWNPNIVANGNDIAL 125

  Fly   119 LRLRNSLTFNS--NIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKT 181
            |:|..:.|.:|  .:|.:....|..|...|..|:|||.....|.:|..|....:..:..|:|.::
Zfish   126 LQLSINATLSSYVQVATLPSYGEILPYGHTCYITGWGRTQTGGSLSAQLKQAYMPVVDHETCSQS 190

  Fly   182 --YLRQLPETTMCLLHPKDKGACYGDSGGP--ATYQGKLV--GLASFVI-GGCGR-AAPDGYERV 238
              :...:.:..:|........||:||||.|  ..:.|:.|  |:.|||. .||.. ..|..:.||
Zfish   191 DWWGSTVKDRMICAGGTTSMSACHGDSGSPLNCLFNGEYVVHGVTSFVASSGCNTYKKPTVFTRV 255

  Fly   239 SKLRNWI 245
            |...:|:
Zfish   256 SYHVSWL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/243 (29%)
Tryp_SPc 28..248 CDD:238113 71/244 (29%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 71/242 (29%)
Tryp_SPc 30..265 CDD:238113 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.