DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and prss1

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001015792.1 Gene:prss1 / 548509 XenbaseID:XB-GENE-5776262 Length:244 Species:Xenopus tropicalis


Alignment Length:247 Identity:75/247 - (30%)
Similarity:119/247 - (48%) Gaps:24/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQ 72
            :|||..|.|..::|.    :||||....:...|:|:|| ..|.|.||||:|:..:||:||||.| 
 Frog     6 VLVLLGAAVAFEDDD----KIVGGFTCTKNAVPYQVSL-NAGYHFCGGSLINSQWVVSAAHCYK- 64

  Fly    73 GNNVAPANELEIQAG--SLLLSSGGVR-VPVATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIA 132
                   :.::::.|  ::.::.|..: :....|..||:|||..  :|:.:::|..:...:|||.
 Frog    65 -------SRIQVRLGEHNIAVNEGTEQFIESQKVIKHPSYNSRNLDNDIMLIKLSTTARLSSNIQ 122

  Fly   133 AIKLATEDPPNDATVDISGWGAISQRGPISNSLLY-VQVKALSRESCQKTYLRQLPETTMC---L 193
            ::.|.:..........|||||.....|.....||. :....|:...|..:|..::.....|   |
 Frog   123 SVPLPSACASAGTNCLISGWGNTLSSGTNYPDLLQCLNAPILTASECSNSYPGEITNNMFCAGFL 187

  Fly   194 LHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            ...||  :|.||||||....|:|.|:.|:..|...|..|..|.:|....:||
 Frog   188 AGGKD--SCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYVSWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/226 (30%)
Tryp_SPc 28..248 CDD:238113 69/227 (30%)
prss1NP_001015792.1 Tryp_SPc 22..240 CDD:238113 69/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.