DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Tpsab1

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:268 Identity:85/268 - (31%)
Similarity:128/268 - (47%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPFWTSLLVLCAAGVLAQNDSVVEPR--IVGGTKAREGQFPHQISLRRRGS---HTCGGSIISKD 61
            ||..:||  :.||..||.      ||  ||||.:|...::|.|:|||...:   |.||||:|...
  Rat    46 LPLLSSL--VHAAPSLAM------PREGIVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQ 102

  Fly    62 YVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNY--NSNGHDVAVLRLRNS 124
            :|:||||||  |.|.|..|:|.:|.....|......:.|:.:..||::  ..:|.|:|:|:|.|.
  Rat   103 WVLTAAHCV--GPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNP 165

  Fly   125 LTFNSNIAAIKL--ATEDPPNDATVDISGWGAISQ--RGPISNSLLYVQVKALSRESCQKTYLRQ 185
            :...||:..:.|  |:|..|:.....::|||.|:.  ..|....|..|||..:....|...|.:.
  Rat   166 VNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKG 230

  Fly   186 L---------PETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIG---GCGRA-APDGYER 237
            |         .:..:|..: :...:|.||||||...:.:...|.:.|:.   ||.:. .|..|.|
  Rat   231 LNTGDNVHIVRDDMLCAGN-EGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTR 294

  Fly   238 VSKLRNWI 245
            |:...:||
  Rat   295 VTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 74/241 (31%)
Tryp_SPc 28..248 CDD:238113 75/240 (31%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 73/238 (31%)
Tryp_SPc 66..302 CDD:238113 73/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.