DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and prss60.2

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:278 Identity:94/278 - (33%)
Similarity:136/278 - (48%) Gaps:49/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TSLLVLCAAGVLAQ----NDSVVEPRIVGGTKAREGQFPHQISLR--RRGSHTCGGSIISKDYVV 64
            |..|::|..|.|:|    ..:.:..|||||..|.||.:|.|:||:  |.|.|.||||:||.::|:
Zfish     8 TLTLLICVKGSLSQLNVCGQAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGGHFCGGSLISSEWVL 72

  Fly    65 TAAHCVKQGNNVAPANELEIQAGSLLLSSG-----GVRV-----PVATVTVHPNYNS--NGHDVA 117
            |||||:       |.    :...||::..|     ||..     .||.:.||.:|||  |.:|:|
Zfish    73 TAAHCL-------PG----VSESSLVVYLGRRTQQGVNTHETSRNVAKIIVHSSYNSNTNDNDIA 126

  Fly   118 VLRLRNSLTFNSNIAAIKLATEDPPNDATVD--ISGWGAISQRG---PISNSLLYVQVKALSRES 177
            :|||.:::|||..|..:.||.::....|...  |:|||.: |.|   |....|....:..::.:.
Zfish   127 LLRLSSAVTFNDYIRPVCLAAQNSVYSAGTSSWITGWGDV-QAGVNLPAPGILQETMIPVVANDR 190

  Fly   178 CQKTYLRQLPETT-----MCL-LHPKDKGACYGDSGGPATYQGKLV----GLASFVIGGCGRAAP 232
            |.    .||...|     :|. |....|..|.||||||...:...|    |:.|:..|.....:|
Zfish   191 CN----AQLGSGTVTNNMICAGLAKGGKDTCQGDSGGPMVTRLCTVWIQAGITSWGYGCADPNSP 251

  Fly   233 DGYERVSKLRNWIAEKAS 250
            ..|.|||:.::||:.|.|
Zfish   252 GVYTRVSQYQSWISSKIS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 84/246 (34%)
Tryp_SPc 28..248 CDD:238113 85/248 (34%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 84/246 (34%)
Tryp_SPc 34..267 CDD:238113 85/248 (34%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.