DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Elane

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:252 Identity:74/252 - (29%)
Similarity:120/252 - (47%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQ 72
            ||.|...|      ..:...||||..||...:|...||:|||.|.||.::|::::|::|||||  
Mouse    15 LLALFLGG------PALASEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCV-- 71

  Fly    73 GNNVAPANELEIQAGSLLLSSGGVRVPV---ATVTVHPNYNSNG-------HDVAVLRLRNSLTF 127
                   |.|..::..::|.:..:|...   .|.:|...: .||       :|:.:::|..|.|.
Mouse    72 -------NGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIF-ENGFDPSQLLNDIVIIQLNGSATI 128

  Fly   128 NSNIAAIKL-ATEDPPNDATVDIS-GWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETT 190
            |:|:...:| |......|.|..:: |||.:....|..:.|..:.|..:: ..|::       ...
Mouse   129 NANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVT-NMCRR-------RVN 185

  Fly   191 MCLLHP-KDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAA-PDGYERVSKLRNWI 245
            :|.|.| :..|.|:||||||......:.|:.||:.||||... ||.:..|::..:||
Mouse   186 VCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFADWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 68/231 (29%)
Tryp_SPc 28..248 CDD:238113 70/232 (30%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 68/231 (29%)
Tryp_SPc 29..245 CDD:238113 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.