DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss53

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:251 Identity:66/251 - (26%)
Similarity:101/251 - (40%) Gaps:77/251 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLL---LSSGGVRV 98
            |::|.|.|:||:|.|.|.||:::..:|:|||||.:: ...|..:...:..|||.   ||.|...|
  Rat    46 GEWPWQASVRRQGVHICSGSLVADTWVLTAAHCFEK-MATAELSSWSVVLGSLKQEGLSPGAEEV 109

  Fly    99 PVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGW--------- 152
            .||.:.:...||  |.|.|:|:|:|.:.:...:  ..:...|...|..|:...:||         
  Rat   110 GVAALQLPKAYNHYSQGSDLALLQLTHPIVHTT--LCLPQPTHHFPFGASCWATGWDQNTSDGKY 172

  Fly   153 -----GAISQRG-----------------------PISNSLLYVQVKALSRESCQKTYLRQLPET 189
                 ...||.|                       |:|.:|..::::.:||.:|...|.|     
  Rat   173 CPRHKSRESQTGSVLTVLALCSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCLYNR----- 232

  Fly   190 TMCLLH------------------PKDKGACYGDSGGPATYQGK-----LVGLASF 222
                ||                  |..:|.|.||||||...:..     .||:.||
  Rat   233 ----LHQRLLANPARSGMLCGGAQPGVQGPCQGDSGGPVMCREPDGHWVQVGIISF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 66/251 (26%)
Tryp_SPc 28..248 CDD:238113 66/251 (26%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 66/251 (26%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.