Sequence 1: | NP_728008.1 | Gene: | CG9676 / 32647 | FlyBaseID: | FBgn0030773 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006230384.1 | Gene: | Prss53 / 499270 | RGDID: | 1566127 | Length: | 591 | Species: | Rattus norvegicus |
Alignment Length: | 251 | Identity: | 66/251 - (26%) |
---|---|---|---|
Similarity: | 101/251 - (40%) | Gaps: | 77/251 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 GQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLL---LSSGGVRV 98
Fly 99 PVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGW--------- 152
Fly 153 -----GAISQRG-----------------------PISNSLLYVQVKALSRESCQKTYLRQLPET 189
Fly 190 TMCLLH------------------PKDKGACYGDSGGPATYQGK-----LVGLASF 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9676 | NP_728008.1 | Tryp_SPc | 27..245 | CDD:214473 | 66/251 (26%) |
Tryp_SPc | 28..248 | CDD:238113 | 66/251 (26%) | ||
Prss53 | XP_006230384.1 | Tryp_SPc | 45..310 | CDD:238113 | 66/251 (26%) |
Tryp_SPc | 341..561 | CDD:238113 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24276 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.100 |