DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss36

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:273 Identity:86/273 - (31%)
Similarity:124/273 - (45%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AQNDSVVEP-----------------RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVT 65
            |..||.|.|                 |||||:.|..|.:|.|:||...|.|.||||:|:..:|::
  Rat    32 AFQDSAVSPTQGEFEDLDCGRPEPSSRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLS 96

  Fly    66 AAHCVKQGNNVAPANELEI------QAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLR 122
            ||||......:.||:|..:      |.|.|   .|.....|||:.|..||:  ..|.|:|:|||.
  Rat    97 AAHCFVTNGTLEPADEWSVLLGVHSQDGPL---EGAHMRSVATILVPDNYSRVELGADLALLRLA 158

  Fly   123 NSLTFNSNIAAIKL--ATEDPPNDATVDISGWGAISQRGPISNS--LLYVQVKALSRESCQKTYL 183
            :......::..:.|  |:....:......:|||.:.:..|:...  |..|::|.|...:||..|.
  Rat   159 SPAKLGPSVKPVCLPRASHLFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYS 223

  Fly   184 R--------QLPETTMCLLHPKD-KGACYGDSGGPATYQ--GK--LVGLASFVIGGCGRA-APDG 234
            |        ||....:|..:|:. :..|.||||||...:  |:  |.|:.||.. ||||. .|..
  Rat   224 RPGPFNLTLQLLPGMLCAGYPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGF-GCGRRNRPGV 287

  Fly   235 YERVSKLRNWIAE 247
            :..|:...:||.|
  Rat   288 FTAVAHYESWIRE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 78/243 (32%)
Tryp_SPc 28..248 CDD:238113 80/246 (33%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 80/246 (33%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.