DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and masp2

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001011037.1 Gene:masp2 / 496446 XenbaseID:XB-GENE-1007491 Length:687 Species:Xenopus tropicalis


Alignment Length:252 Identity:71/252 - (28%)
Similarity:120/252 - (47%) Gaps:47/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISL---RRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGS 88
            |||||..|..|:||.|:.:   ..||    ||:::..::::||||.|...:::   :.:.|:.|.
 Frog   443 RIVGGEFANVGEFPWQVFINANNERG----GGALLLDNWILTAAHVVYSYDDL---SSILIKMGF 500

  Fly    89 L-LLSSGGVRVPVATVTVHPNYNSNGH---DVAVLRLRNSLTFN-SNIAAIKLAT---------E 139
            | ...|..:|.....|.:|..|.. ||   |:|:::|:|.:..: .:|..|.|.|         :
 Frog   501 LSTQDSNYIRGWPEAVFIHEGYKP-GHYNNDIALIKLKNKVPLSEESILGICLPTKEKSYHISHK 564

  Fly   140 DPPNDATVDISGWGAI-SQRGPISNSLLYVQVKALSRESCQKTYLRQ-----LPETTMCL---LH 195
            |..|...: ::|||.. :||.  |..|.:|:|..:...:|:..|.:.     :.|..:|.   :.
 Frog   565 DDDNHVGL-VAGWGLTEAQRS--SRKLRFVEVNIVDHSTCKAEYAKLDAQYIVTENMICAGFEIG 626

  Fly   196 PKDKGACYGDSGGPATYQGK------LVGLASFVIGGCGRAAPDG-YERVSKLRNWI 245
            .||  :|.|||||...:...      :.|:.|:.: |||.|...| |.:|:...:||
 Frog   627 VKD--SCAGDSGGALAFMNAESKKWFVGGIVSWGV-GCGVARQYGVYTKVTNYLDWI 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/250 (28%)
Tryp_SPc 28..248 CDD:238113 70/251 (28%)
masp2NP_001011037.1 CUB 30..139 CDD:238001
FXa_inhibition 145..180 CDD:317114
CUB 184..294 CDD:238001
CCP 299..361 CDD:153056
CCP 365..430 CDD:153056
Tryp_SPc 443..680 CDD:214473 69/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.