DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP010240

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001238153.2 Gene:AgaP_AGAP010240 / 4578338 VectorBaseID:AGAP010240 Length:275 Species:Anopheles gambiae


Alignment Length:241 Identity:86/241 - (35%)
Similarity:127/241 - (52%) Gaps:24/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91
            |||.|..|..||||:|:.|...||..||||:||.::|:|||||      ....::..::|||:..
Mosquito    43 RIVNGFPASLGQFPYQVFLIGDGSLACGGSLISAEWVLTAAHC------QVGISQFTVRAGSIQN 101

  Fly    92 SSGGVRVPVATVTVHPNYN-SN-GHDVAVLRLRNSLTFNSNIAAIKLATEDPP-----NDATVDI 149
            :|||.......:.:||||| || .:|:.::||...:....||..:.|...:..     .:|||  
Mosquito   102 NSGGTVRTSNLIIIHPNYNPSNLNNDIGLIRLNEPMPLGGNIQVVALPEANLSETFLNREATV-- 164

  Fly   150 SGWGAISQ-RGPISNSLLYVQVKALSRESCQKTY-LRQLPETTMCLL--HPKDKGACYGDSGGPA 210
            ||:|..|. .|.||.:|.:|.:..:|...|..|| ...:.::|:|.:  ...::|.|.||||||.
Mosquito   165 SGFGRTSDASGAISPNLNFVHLNIISNIQCMGTYGSATIIDSTVCAVGRDAPNQGTCNGDSGGPL 229

  Fly   211 TY----QGKLVGLASFV-IGGCGRAAPDGYERVSKLRNWIAEKASL 251
            |.    |...:|:.||| ..||....|.||.|.:..||||.:::.:
Mosquito   230 TVTENGQSVQIGVVSFVAAAGCEVGFPSGYVRTTHFRNWIRDQSGI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 84/233 (36%)
Tryp_SPc 28..248 CDD:238113 85/235 (36%)
AgaP_AGAP010240XP_001238153.2 Tryp_SPc 43..269 CDD:214473 84/233 (36%)
Tryp_SPc 44..272 CDD:238113 85/235 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.